Structure of PDB 6gen Chain A

Receptor sequence

>6genA (length=97) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKEIKLARRLRGE

3D structure

PDB

6gen Structure and dynamics of the yeast SWR1-nucleosome complex.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R83 F84 Q85 S86 R116 T118	R47 F48 Q49 S50 R80 T82
BS02	dna	A	R40 Y41 P43 G44 V46 R63 K64 L65	R4 Y5 P7 G8 V10 R27 K28 L29

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0008823	cupric reductase (NADH) activity
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006878	intracellular copper ion homeostasis
GO:0009060	aerobic respiration
GO:0009303	rRNA transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0043935	sexual sporulation resulting in formation of a cellular spore
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0070911	global genome nucleotide-excision repair

	Cellular Component
GO:0000500	RNA polymerase I upstream activating factor complex
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:6gen, PDBe:6gen, PDBj:6gen
PDBsum	6gen
PubMed	30309918
UniProt	P61830\|H3_YEAST Histone H3 (Gene Name=HHT1)