Structure of PDB 6geh Chain A

Receptor sequence

>6gehA (length=256) Species: 318167 (Shewanella frigidimarina NCIMB 400) [Search protein sequence]

SPTRLTYISDIIEISPYLRRLVLSGEQLANFPADQQGAYVKVLIPQPGET
TVNMTLTGPNAAIKRSYTIREFDPVRGQLSLDFVINKHTGPATDWAKLAN
VGDTVAIAGPGPLKMNRFDFNDYLLFGDSTSINAVDALIKRLPATAKGHI
IMLVNSHQEQALLSQHPLLKTHWLVLNDSITAEQQIDWLLDKLELFGDLP
AVTQVFVGLEATQVRVIKQYLLEQQQLPLSSISATGYWKRNTDADTFGKQ
KQMQPL

3D structure

PDB

6geh Structure and reactivity of a siderophore-interacting protein from the marine bacteriumShewanellareveals unanticipated functional versatility.

Chain

Resolution

1.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MG	A	V92 I93 N94 K95 H96 T101	V84 I85 N86 K87 H88 T93
BS02	MG	A	L13 G33 Q35	L5 G25 Q27
BS03	MG	A	A145 R149	A137 R141
BS04	FAD	A	Y47 R73 S74 Y75 T76 D90 V92 H96 T97 P99 A100 T101 T138 Y245 W246 K247 R248 N249 T250 D251 A252	Y39 R65 S66 Y67 T68 D82 V84 H88 T89 P91 A92 T93 T130 Y237 W238 K239 R240 N241 T242 D243 A244

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding
GO:0052851	ferric-chelate reductase (NADPH) activity
GO:0071949	FAD binding

	Biological Process
GO:0010106	cellular response to iron ion starvation
GO:0015891	siderophore transport
GO:0033212	iron import into cell

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6geh, PDBe:6geh, PDBj:6geh
PDBsum	6geh
PubMed	30420426
UniProt	Q080S8

[Back to BioLiP]