Structure of PDB 6gcv Chain A |
>6gcvA (length=126) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
MSISPETINVAGAQRMLSQKMAREALQLRLGAGDPKALAATIAQYERSAA DLDAGNAERNVSRMGAPEIAAQRQKVAQIWGRYRAMLDQVAQPASQVDLR GFSQYSTELLGELNNLVSLMSARADS |
|
PDB | 6gcv The Molecular Mechanism of Nitrate Chemotaxis via Direct Ligand Binding to the PilJ Domain of McpN. |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NO3 |
A |
G25 R28 |
G12 R15 |
|
|
|