Structure of PDB 6gb7 Chain A

Receptor sequence
>6gb7A (length=271) Species: 10090 (Mus musculus) [Search protein sequence]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNLLRTDSPKAHVTHHPRGEVTLRCW
ALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKE
QNYTCRVYHEGLPEPLTLRWE
3D structure
PDB6gb7 Successive crystal structure snapshots suggest the basis for MHC class I peptide loading and editing by tapasin.
ChainA
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y7 E63 K66 Q70 W73 Q97 S150 A152 H155 Y156 Y159 E163 W167 Y171 Y7 E63 K66 Q70 W73 Q97 S150 A152 H155 Y156 Y159 E163 W167 Y171
BS02 peptide A W73 S77 Y84 T143 W147 W73 S77 Y84 T143 W147
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0006955 immune response
GO:0010977 negative regulation of neuron projection development
GO:0019882 antigen processing and presentation
Cellular Component
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gb7, PDBe:6gb7, PDBj:6gb7
PDBsum6gb7
PubMed30808808
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]