Structure of PDB 6g81 Chain A |
>6g81A (length=117) Species: 85963 (Helicobacter pylori J99) [Search protein sequence] |
MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFET FREESLVCKDAILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKNVI ITQGNEMRLLSLEMLAE |
|
PDB | 6g81 Structure and dynamics of Helicobacter pylori nickel-chaperone HypA: an integrated approach using NMR spectroscopy, functional assays and computational tools. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C74 C77 C91 |
C74 C77 C91 |
|
|
|
|