Structure of PDB 6g4t Chain A

Receptor sequence

>6g4tA (length=259) Species: 9606 (Homo sapiens)

GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEA
CMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDV
GSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDE
HPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPL
SESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKG
RVVKASFRA

3D structure

• PDB: 6g4t The Crystal Structure of a hCA VII Variant Provides Insights into the Molecular Determinants Responsible for Its Catalytic Behavior.
• Chain: A
• Resolution: 1.91 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H64 H94 H96 E106 H119 T199
• Catalytic site (residue number reindexed from 1): H61 H91 H93 E103 H116 T196
• Enzyme Commision number: 4.2.1.1: carbonic anhydrase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H94 H96 H119	H91 H93 H116

Gene Ontology

Molecular Function

• GO:0004089 carbonate dehydratase activity
• GO:0008270 zinc ion binding
• GO:0016829 lyase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0032230 positive regulation of synaptic transmission, GABAergic
• GO:0032849 positive regulation of cellular pH reduction
• GO:0051453 regulation of intracellular pH
• GO:0070050 neuron cellular homeostasis
• GO:2001225 regulation of chloride transport

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6g4t, PDBe:6g4t, PDBj:6g4t
• PDBsum: 6g4t
• PubMed: 29795045
• UniProt: P43166|CAH7_HUMAN Carbonic anhydrase 7 (Gene Name=CA7)