Structure of PDB 6g3z Chain A

Receptor sequence

>6g3zA (length=293) Species: 2287 (Saccharolobus solfataricus)

PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLS
PEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAP
YYYPRMSEKHLVKYFKTLCEVSPHPVYLYNYPTATGKDIDAKVAKEIGCF
TGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAAGSN
YLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKY
FQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILKE

3D structure

• PDB: 6g3z Insights into the Substrate Specificity of Archaeal Entner-Doudoroff Aldolases: The Structures of Picrophilus torridus 2-Keto-3-deoxygluconate Aldolase and Sulfolobus solfataricus 2-Keto-3-deoxy-6-phosphogluconate Aldolase in Complex with 2-Keto-3-deoxy-6-phosphogluconate.
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T43 Y103 Y130 A135 K155 V196
• Catalytic site (residue number reindexed from 1): T42 Y102 Y129 A134 K154 V195
• Enzyme Commision number: 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ELE	A	P7 G42 T43 T44 Y130 Y132 K155 T157	P6 G41 T42 T43 Y129 Y131 K154 T156

Gene Ontology

Molecular Function

• GO:0008674 2-dehydro-3-deoxy-6-phosphogalactonate aldolase activity
• GO:0008675 2-dehydro-3-deoxy-phosphogluconate aldolase activity
• GO:0008840 4-hydroxy-tetrahydrodipicolinate synthase activity
• GO:0016829 lyase activity

External links

• PDB: RCSB:6g3z, PDBe:6g3z, PDBj:6g3z
• PDBsum: 6g3z
• PubMed: 29812914
• UniProt: O54288|KDGA_SACSO 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase