Structure of PDB 6fz5 Chain A

Receptor sequence

>6fz5A (length=382) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLI
REITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHL
SRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTP
VMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHK
SLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEK
LKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 6fz5 How To Design Selective Ligands for Highly Conserved Binding Sites: A Case Study UsingN-Myristoyltransferases as a Model System.
• Chain: A
• Resolution: 1.89 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BXN	A	F188 F190 T282 Y296 H298 F311 S405 Y420 Q496	F74 F76 T168 Y182 H184 F197 S291 Y306 Q382	MOAD: Ki=430nM BindingDB: Ki=18nM
BS02	MYA	A	Y117 F119 W120 Y180 V181 I245 L248 V250 R255 S256 R258 A260 P261 T268 A279 Y281 T282 Y479	Y3 F5 W6 Y66 V67 I131 L134 V136 R141 S142 R144 A146 P147 T154 A165 Y167 T168 Y365
BS03	MG	A	L254 R255 K257 V259	L140 R141 K143 V145

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6fz5, PDBe:6fz5, PDBj:6fz5
• PDBsum: 6fz5
• PubMed: 31423787
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)