Structure of PDB 6fz3 Chain A

Receptor sequence

>6fz3A (length=387) Species: 9606 (Homo sapiens)

LYFQGRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWD
ALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQ
WHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRV
APVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEV
KFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQ
FHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMN
HPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENK
TFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 6fz3 How To Design Selective Ligands for Highly Conserved Binding Sites: A Case Study UsingN-Myristoyltransferases as a Model System.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EBK	A	D183 F188 F190 N246 T282 G284 Y296 H298 F311 S405 Y420 G472 L495 Q496	D74 F79 F81 N137 T173 G175 Y187 H189 F202 S296 Y311 G363 L386 Q387	BindingDB: IC50=25nM,Ki=0.900000nM
BS02	MYA	A	Y117 F119 W120 Y180 I245 L248 V250 R255 S256 R258 A260 T268 Q278 Y281 T282 L287 Y479	Y8 F10 W11 Y71 I136 L139 V141 R146 S147 R149 A151 T159 Q169 Y172 T173 L178 Y370
BS03	MG	A	L254 R255 K257 V259	L145 R146 K148 V150

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6fz3, PDBe:6fz3, PDBj:6fz3
• PDBsum: 6fz3
• PubMed: 31423787
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)