Structure of PDB 6fz2 Chain A

Receptor sequence

>6fz2A (length=374) Species: 9606 (Homo sapiens)

SYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGD
RGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVR
VVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIR
EITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHNM
TMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQ
EEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNKSLKAAYSF
YNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDG
NLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 6fz2 How To Design Selective Ligands for Highly Conserved Binding Sites: A Case Study UsingN-Myristoyltransferases as a Model System.
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	31A	A	E182 D183 F188 F190 Y296 F311 Y401 S405 Y420 Q496	E67 D68 F73 F75 Y181 F196 Y283 S287 Y298 Q374
BS02	MYA	A	Y117 Q118 F119 W120 Y180 I245 L248 C249 V250 R255 S256 R258 A260 P261 T268 V271 A279 Y281 T282 Y479	Y2 Q3 F4 W5 Y65 I130 L133 C134 V135 R140 S141 R143 A145 P146 T153 V156 A164 Y166 T167 Y357
BS03	MG	A	K257 V259	K142 V144

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6fz2, PDBe:6fz2, PDBj:6fz2
• PDBsum: 6fz2
• PubMed: 31423787
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)