Structure of PDB 6fyh Chain A |
>6fyhA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
PTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTS KVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFE KLRHMLLLAIQENSE |
|
PDB | 6fyh beta-Sheet Augmentation Is a Conserved Mechanism of Priming HECT E3 Ligases for Ubiquitin Ligation. |
Chain | A |
Resolution | 2.906 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H350 C352 |
Catalytic site (residue number reindexed from 1) |
H85 C87 |
Enzyme Commision number |
2.3.2.26: HECT-type E3 ubiquitin transferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H350 D357 |
H85 D92 |
|
|
|
|