Structure of PDB 6fu3 Chain A

Receptor sequence

>6fu3A (length=329) Species: 485 (Neisseria gonorrhoeae)

MGEDQDLLKRAQGVFQPLPTVEEMQKIRPFTEEQVKLGHQLWYEPRLSKG
NTVSCNSCHNLASAGVDNMPTSQGHKGQFGGRNSPTALNAALLGSQFWDG
RAADVEEQAGGPLVNPVEMANDSQEAAAAKIAKVPEYQEMFKKAFPEDGA
VSFKNITTALGAFERTLLTPTKWDEYLKGNVNALSEQERKGVRAFMDNGC
IACHNGVNLGGTTFQKFGLVQGPYWKFIEDPKRDKGRADVTKKTEDEFFF
RVPGLRNVAKTYPYFHNGSVWELDKAVTIMGKAQLGKDIPKEDVDNIVVF
LNALSGNVSESARTMPELPLTAPMESKPD

3D structure

• PDB: 6fu3 Structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium Neisseria gonorrhoeae
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	N83 T261 P263	N83 T261 P263
BS02	HEC	A	C55 C58 H59 Q73 R82 N83 S84 P85 Q96 F97 W98 Q108 P112 E118 M119 E164 R251	C55 C58 H59 Q73 R82 N83 S84 P85 Q96 F97 W98 Q108 P112 E118 M119 E164 R251
BS03	HEC	A	F195 C200 C203 H204 Q215 F217 F250 P253 L255 Y264 F265 H266 M280 Q284 L285	F195 C200 C203 H204 Q215 F217 F250 P253 L255 Y264 F265 H266 M280 Q284 L285

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:6fu3, PDBe:6fu3, PDBj:6fu3
• PDBsum: 6fu3
• UniProt: Q5F5Z9