Structure of PDB 6fq8 Chain A

Receptor sequence
>6fq8A (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRG
3D structure
PDB6fq8 Structural rearrangements of the histone octamer translocate DNA.
ChainA
Resolution4.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R40 Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118 M120 R3 Y4 R5 T8 R26 R35 R46 F47 Q48 R79 V80 T81 M83
BS02 dna A H39 R40 Y41 P43 G44 V46 K56 R63 K64 L65 R69 D81 R83 H2 R3 Y4 P6 G7 V9 K19 R26 K27 L28 R32 D44 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6fq8, PDBe:6fq8, PDBj:6fq8
PDBsum6fq8
PubMed29626188
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]