Structure of PDB 6fq6 Chain A

Receptor sequence
>6fq6A (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRG
3D structure
PDB6fq6 Structural rearrangements of the histone octamer translocate DNA.
ChainA
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 P43 T45 R63 R72 R83 R116 V117 T118 M120 Y5 R6 P7 T9 R27 R36 R47 R80 V81 T82 M84
BS02 dna A H39 R40 Y41 V46 A47 R53 R63 K64 L65 P66 R69 R83 H3 R4 Y5 V10 A11 R17 R27 K28 L29 P30 R33 R47
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6fq6, PDBe:6fq6, PDBj:6fq6
PDBsum6fq6
PubMed29626188
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]