Structure of PDB 6fq5 Chain A

Receptor sequence
>6fq5A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6fq5 Structural rearrangements of the histone octamer translocate DNA.
ChainA
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K37 R42 T45 R63 R72 R83 F84 R116 V117 T118 M120 K1 R6 T9 R27 R36 R47 F48 R80 V81 T82 M84
BS02 dna A R40 Y41 A47 R49 L65 P66 R69 R4 Y5 A11 R13 L29 P30 R33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6fq5, PDBe:6fq5, PDBj:6fq5
PDBsum6fq5
PubMed29626188
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]