Structure of PDB 6fp5 Chain A |
>6fp5A (length=84) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
MDALCRVCHTASPRCLPLFKPLDDPISGKPATLASILSYCSGLEILEAEL FLPHHICPDCVAKLRLSLEFKRSVHRMDRILRQT |
|
PDB | 6fp5 Structural basis of diversity and homodimerization specificity of zinc-finger-associated domains in Drosophila. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C14 C17 C66 C69 |
C5 C8 C57 C60 |
|
|
|
|