Structure of PDB 6fon Chain A

Receptor sequence

>6fonA (length=252) Species: 9606 (Homo sapiens)

QGTLCTLEFAVQMTSQSSVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTL
PSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQ
LTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGG
PQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDL
GRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGR
PI

3D structure

• PDB: 6fon Molecular recognition and maturation of SOD1 by its evolutionarily destabilised cognate chaperone hCCS.
• Chain: A
• Resolution: 3.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H130 H132 H147 H155 H164 D167 D201 R224
• Catalytic site (residue number reindexed from 1): H123 H125 H140 H148 H157 D160 D194 R217

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H147 H155 H164 D167	H140 H148 H157 D160

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0005515 protein binding
• GO:0015035 protein-disulfide reductase activity
• GO:0016532 superoxide dismutase copper chaperone activity
• GO:0045296 cadherin binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006801 superoxide metabolic process
• GO:0015680 protein maturation by copper ion transfer
• GO:0019430 removal of superoxide radicals
• GO:0034599 cellular response to oxidative stress

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:6fon, PDBe:6fon, PDBj:6fon
• PDBsum: 6fon
• PubMed: 30735496
• UniProt: O14618|CCS_HUMAN Copper chaperone for superoxide dismutase (Gene Name=CCS)