Structure of PDB 6fnz Chain A |
>6fnzA (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] |
VRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVK KLYTLDGKQVTCLHDFFGDDDVFIACGP |
|
PDB | 6fnz Domain swap in the C-terminal ubiquitin-like domain of human doublecortin. |
Chain | A |
Resolution | 2.23 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
S268 G269 R273 |
S11 G12 R16 |
|
|
|
|