Structure of PDB 6fkz Chain A

Receptor sequence

>6fkzA (length=264) Species: 7955 (Danio rerio) [Search protein sequence]

DLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATP
EAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQQGRSVVII
TQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGKG
APDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERE
LEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNMECTPATQRFKYH
FEGPCGSTLPPALE

3D structure

PDB

6fkz Potent and Selective Inhibitors of Human Sirtuin 5.

Chain

Resolution

3.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	P64 T65 F66 R67 N137 D139 H154
Catalytic site (residue number reindexed from 1)	P30 T31 F32 R33 N103 D105 H120
Enzyme Commision number	2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	R67 A78 Y98 R101 I138 H154 V216 V217 F219 T222 L223 Y251 M255	R33 A44 Y64 R67 I104 H120 V182 V183 F185 T188 L189 Y217 M221
BS02	peptide	A	T65 R67 Y98 R101 H154 V217 F219 T222 L223 Y251 M255	T31 R33 Y64 R67 H120 V183 F185 T188 L189 Y217 M221
BS03	ZN	A	C162 C165 C203 C208	C128 C131 C169 C174

Gene Ontology

	Molecular Function
GO:0000035	acyl binding
GO:0008270	zinc ion binding
GO:0016740	transferase activity
GO:0017136	NAD-dependent histone deacetylase activity
GO:0034979	NAD-dependent protein lysine deacetylase activity
GO:0036054	protein-malonyllysine demalonylase activity
GO:0036055	protein-succinyllysine desuccinylase activity
GO:0046872	metal ion binding
GO:0061697	protein-glutaryllysine deglutarylase activity
GO:0070403	NAD+ binding
GO:1901363	heterocyclic compound binding

	Biological Process
GO:0006338	chromatin remodeling
GO:0006476	protein deacetylation
GO:0010566	regulation of ketone biosynthetic process
GO:0036047	peptidyl-lysine demalonylation
GO:0036048	protein desuccinylation
GO:0036049	peptidyl-lysine desuccinylation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fkz, PDBe:6fkz, PDBj:6fkz
PDBsum	6fkz
PubMed	29494161
UniProt	Q6DHI5\|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=sirt5)

[Back to BioLiP]