Structure of PDB 6fky Chain A

Receptor sequence

>6fkyA (length=262) Species: 7955 (Danio rerio) [Search protein sequence]

DLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATP
EAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQQGRSVVII
TQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGKG
APDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERE
LEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNMECTPATQKYHFE
GPCGSTLPPALE

3D structure

PDB

6fky Potent and Selective Inhibitors of Human Sirtuin 5.

Chain

Resolution

2.98 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	P64 T65 F66 R67 N137 D139 H154
Catalytic site (residue number reindexed from 1)	P30 T31 F32 R33 N103 D105 H120
Enzyme Commision number	2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	H154 V217 E221 T222 L223 Y251 M255	H120 V183 E187 T188 L189 Y217 M221
BS02	peptide	A	H154 V217 E221 T222 L223 Y251 M255	H120 V183 E187 T188 L189 Y217 M221
BS03	ZN	A	C162 C165 C203 C208	C128 C131 C169 C174
BS04	E9N	A	T65 Y98 R101 Q136 N137 I138 H154 V216	T31 Y64 R67 Q102 N103 I104 H120 V182	PDBbind-CN: -logKd/Ki=6.49,Ki=320nM
BS05	DZK	A	T65 R67 A82 Y98 R101 I138	T31 R33 A48 Y64 R67 I104

Gene Ontology

	Molecular Function
GO:0000035	acyl binding
GO:0008270	zinc ion binding
GO:0016740	transferase activity
GO:0017136	NAD-dependent histone deacetylase activity
GO:0034979	NAD-dependent protein lysine deacetylase activity
GO:0036054	protein-malonyllysine demalonylase activity
GO:0036055	protein-succinyllysine desuccinylase activity
GO:0046872	metal ion binding
GO:0061697	protein-glutaryllysine deglutarylase activity
GO:0070403	NAD+ binding
GO:1901363	heterocyclic compound binding

	Biological Process
GO:0006338	chromatin remodeling
GO:0006476	protein deacetylation
GO:0010566	regulation of ketone biosynthetic process
GO:0036047	peptidyl-lysine demalonylation
GO:0036048	protein desuccinylation
GO:0036049	peptidyl-lysine desuccinylation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fky, PDBe:6fky, PDBj:6fky
PDBsum	6fky
PubMed	29494161
UniProt	Q6DHI5\|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=sirt5)

[Back to BioLiP]