Structure of PDB 6fj1 Chain A

Receptor sequence

>6fj1A (length=253) Species: 1352 (Enterococcus faecium)

GLKEQLASMNAIANVKATYSINGETFQIPSSDIMSWLTYNDGKVDLDTEQ
VRQYVTDLGTKYNTSTNDTKFKSTKRGEVTVPVGTYSWTIQTDSETEALK
KAILAGQDFTRSPIVQGGTTADHPLIEDTYIEVDLENQHMWYYKDGKVAL
ETDIVSGKPTTPTPAGVFYVWNKEEDATLKGTNGTPYESPVNYWMPIDWT
GVGIHDSDWQPEYGGDLWKTRGSHGCINTPPSVMKELFGMVEKGTPVLVF
GSH

3D structure

• PDB: 6fj1 Synthesis of Avibactam Derivatives and Activity on beta-Lactamases and Peptidoglycan Biosynthesis Enzymes of Mycobacteria.
• Chain: A
• Resolution: 2.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NXL	A	L395 K396 Y403 S405 H421 W425 S439 H440 G441 C442	L179 K180 Y187 S189 H205 W209 S223 H224 G225 C226

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 02:23:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6fj1', asym_id = 'A', title = 'Synthesis of Avibactam Derivatives and Activity ...ptidoglycan Biosynthesis Enzymes of Mycobacteria.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6fj1', asym_id='A', title='Synthesis of Avibactam Derivatives and Activity ...ptidoglycan Biosynthesis Enzymes of Mycobacteria.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016740', uniprot = '', pdbid = '6fj1', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016740', uniprot='', pdbid='6fj1', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>