Structure of PDB 6ff5 Chain A

Receptor sequence
>6ff5A (length=104) Species: 9913 (Bos taurus) [Search protein sequence]
GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTD
ANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKK
ATNE
3D structure
PDB6ff5 X-ray structure of bovine heart cytochrome c at high ionic strength.
ChainA
Resolution1.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEC A K13 C14 C17 H18 G29 P30 G41 Y48 T49 N52 W59 Y67 T78 K79 M80 I81 F82 K13 C14 C17 H18 G29 P30 G41 Y48 T49 N52 W59 Y67 T78 K79 M80 I81 F82
BS02 NO3 A K87 E90 K87 E90
BS03 NO3 A E69 K86 E69 K86
BS04 SO4 A K7 K100 E104 K7 K100 E104
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:0006915 apoptotic process
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ff5, PDBe:6ff5, PDBj:6ff5
PDBsum6ff5
PubMed29516298
UniProtP62894|CYC_BOVIN Cytochrome c (Gene Name=CYCS)

[Back to BioLiP]