Structure of PDB 6fd1 Chain A

Receptor sequence
>6fd1A (length=106) Species: 354 (Azotobacter vinelandii) [Search protein sequence]
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECP
AQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGK
LQHLER
3D structure
PDB6fd1 Structure of Azotobacter vinelandii 7Fe ferredoxin at 1.35 A resolution and determination of the [Fe-S] bonds with 0.01 A accuracy.
ChainA
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 A F2 C20 P21 C24 F25 I34 C39 I40 D41 C42 A43 C45 F2 C20 P21 C24 F25 I34 C39 I40 D41 C42 A43 C45
BS02 F3S A C8 K12 Y13 T14 D15 C16 C49 I54 C8 K12 Y13 T14 D15 C16 C49 I54
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding

View graph for
Molecular Function
External links
PDB RCSB:6fd1, PDBe:6fd1, PDBj:6fd1
PDBsum6fd1
PubMed9600844
UniProtP00214|FER1_AZOVI Ferredoxin-1 (Gene Name=fdxA)

[Back to BioLiP]