Structure of PDB 6fci Chain A

Receptor sequence
>6fciA (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]
ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
ATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASY
SLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVL
ECVSLVELTSLKGREKLAPVPFFSLLQYE
3D structure
PDB6fci Structural Insights into the Forward and Reverse Enzymatic Reactions in Human Adenine Phosphoribosyltransferase.
ChainA
Resolution1.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.4.2.7: adenine phosphoribosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PRP A S66 R67 K88 L103 E104 Y105 D127 D128 L129 A131 T132 G133 T135 S65 R66 K87 L102 E103 Y104 D126 D127 L128 A130 T131 G132 T134
BS02 ADE A F26 R27 R67 E104 Y105 L129 F25 R26 R66 E103 Y104 L128
Gene Ontology
Molecular Function
GO:0002055 adenine binding
GO:0003999 adenine phosphoribosyltransferase activity
GO:0005515 protein binding
GO:0016208 AMP binding
GO:0016757 glycosyltransferase activity
Biological Process
GO:0006166 purine ribonucleoside salvage
GO:0006168 adenine salvage
GO:0007625 grooming behavior
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0044209 AMP salvage
GO:0046083 adenine metabolic process
Cellular Component
GO:0005576 extracellular region
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0034774 secretory granule lumen
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fci, PDBe:6fci, PDBj:6fci
PDBsum6fci
PubMed29576532
UniProtP07741|APT_HUMAN Adenine phosphoribosyltransferase (Gene Name=APRT)

[Back to BioLiP]