Structure of PDB 6fbq Chain A

Receptor sequence
>6fbqA (length=80) Species: 9606 (Homo sapiens) [Search protein sequence]
FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLI
DKRQRNRCQYCRYQKCLAMGMKREAVQEER
3D structure
PDB6fbq Modulation of RXR-DNA complex assembly by DNA context.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A S143 K145 H146 Y147 K156 R164 Q206 E208 R209 S14 K16 H17 Y18 K27 R35 Q77 E79 R80
BS02 dna A E153 G154 R161 R184 N185 Q188 R191 E24 G25 R32 R55 N56 Q59 R62
BS03 ZN A C135 C138 C152 C155 C6 C9 C23 C26
BS04 ZN A C171 C177 C187 C190 C42 C48 C58 C61
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fbq, PDBe:6fbq, PDBj:6fbq
PDBsum6fbq
PubMed30476562
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]