Structure of PDB 6fb8 Chain A

Receptor sequence

>6fb8A (length=154) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDAA

3D structure

• PDB: 6fb8 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
• Chain: A
• Resolution: 2.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G19 D20
• Catalytic site (residue number reindexed from 1): G18 D19
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G19 D20 G21 S22 I24 Q26 K28 N30 T46 Q47 K48 A133 N136 D137 S138 R141 K142	G18 D19 G20 S21 I23 Q25 K27 N29 T45 Q46 K47 A132 N135 D136 S137 R140 K141
BS02	dna	A	S32 Y33 K34 Q38 R68 R70 E80 I81 K139	S31 Y32 K33 Q37 R67 R69 E79 I80 K138
BS03	MG	A	A134 N136	A133 N135

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:6fb8, PDBe:6fb8, PDBj:6fb8
• PDBsum: 6fb8
• PubMed: 29980759
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI