Structure of PDB 6fb7 Chain A

Receptor sequence

>6fb7A (length=152) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD

3D structure

• PDB: 6fb7 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
• Chain: A
• Resolution: 2.689 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G19 D20
• Catalytic site (residue number reindexed from 1): G18 D19
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D20 T46 Q47 K48	D19 T45 Q46 K47
BS02	dna	A	G19 D20 G21 S22 Q26 K28 N30 Q44 N136 D137 S138 T140 R141 K142	G18 D19 G20 S21 Q25 K27 N29 Q43 N135 D136 S137 T139 R140 K141
BS03	dna	A	S32 Y33 K34 Q38 Y66 R68 R70 E80 I81 K116	S31 Y32 K33 Q37 Y65 R67 R69 E79 I80 K115

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:6fb7, PDBe:6fb7, PDBj:6fb7
• PDBsum: 6fb7
• PubMed: 29980759
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI