Structure of PDB 6fb2 Chain A

Receptor sequence

>6fb2A (length=153) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDSDGSIIAQIKPNQSVKFKHRLQLTFDVTQKTQR
RWFLDKLVDEIGVGYVADSGSVSKYRLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS

3D structure

• PDB: 6fb2 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
• Chain: A
• Resolution: 2.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S19 D20
• Catalytic site (residue number reindexed from 1): S18 D19
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D20 T46 Q47 K48	D19 T45 Q46 K47
BS02	dna	A	S32 V33 R38 Y66 I81 K139	S31 V32 R37 Y65 I80 K138
BS03	dna	A	S19 D20 S22 I24 Q26 K28 K75 R77 A133 N136 D137 S138 T140 R141 K142	S18 D19 S21 I23 Q25 K27 K74 R76 A132 N135 D136 S137 T139 R140 K141

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:6fb2, PDBe:6fb2, PDBj:6fb2
• PDBsum: 6fb2
• PubMed: 29980759
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI