Structure of PDB 6fb1 Chain A

Receptor sequence

>6fb1A (length=153) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDSDGSIIAQIKPNQSVKFKHRLQLTFDVTQKTQR
RWFLDKLVDEIGVGYVADSGSVSKYRLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS

3D structure

• PDB: 6fb1 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
• Chain: A
• Resolution: 3.024 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S19 D20
• Catalytic site (residue number reindexed from 1): S18 D19
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D20 T46 Q47 K48 V73	D19 T45 Q46 K47 V72
BS02	dna	A	S32 V33 R38 Y66 E80 I81	S31 V32 R37 Y65 E79 I80
BS03	dna	A	S19 S22 I24 Q26 K28 T46 K75 R77 N136 D137 T140 R141 K142	S18 S21 I23 Q25 K27 T45 K74 R76 N135 D136 T139 R140 K141

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:6fb1, PDBe:6fb1, PDBj:6fb1
• PDBsum: 6fb1
• PubMed: 29980759
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI