Structure of PDB 6fb0 Chain A

Receptor sequence
>6fb0A (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
NTKYNKEFLLYLAGFVDSDGSIIAQIKPNQSVKFKHRLQLTFDVTQKTQR
RWFLDKLVDEIGVGYVADSGSVSKYRLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS
3D structure
PDB6fb0 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
ChainA
Resolution2.15 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S19 D20
Catalytic site (residue number reindexed from 1) S18 D19
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A S19 D20 G21 S22 I24 Q26 K28 T46 Q47 K48 K75 R77 N136 D137 S138 T140 R141 K142 S18 D19 G20 S21 I23 Q25 K27 T45 Q46 K47 K74 R76 N135 D136 S137 T139 R140 K141 PDBbind-CN: Kd=100nM
BS02 dna A S32 V33 R38 Y66 I81 K139 S31 V32 R37 Y65 I80 K138 PDBbind-CN: Kd=100nM
BS03 CA A A134 N136 A133 N135
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fb0, PDBe:6fb0, PDBj:6fb0
PDBsum6fb0
PubMed29980759
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]