Structure of PDB 6f4d Chain A

Receptor sequence

>6f4dA (length=304) Species: 2336 (Thermotoga maritima)

HHHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAM
ELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIRE
YREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPD
RNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHP
ECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDR
EFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMF
ELMG

3D structure

• PDB: 6f4d Crystallographic Trapping of Reaction Intermediates in Quinolinic Acid Synthesis by NadA.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.72: quinolinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C81 N109 C168 V170 E195 C254	C87 N115 C174 V176 E201 C260
BS02	PGH	A	H19 F21 D35 S36 H171 H193 E195 S209 T210	H25 F27 D41 S42 H177 H199 E201 S215 T216
BS03	PO4	A	H19 S36 H193 S209 T210	H25 S42 H199 S215 T216
BS04	PO4	A	R41 K215	R47 K221

Gene Ontology

Molecular Function

• GO:0008987 quinolinate synthetase A activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009435 NAD biosynthetic process
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0019805 quinolinate biosynthetic process
• GO:0034628 'de novo' NAD biosynthetic process from aspartate

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6f4d, PDBe:6f4d, PDBj:6f4d
• PDBsum: 6f4d
• PubMed: 29641168
• UniProt: Q9X1X7|NADA_THEMA Quinolinate synthase (Gene Name=nadA)