Structure of PDB 6f48 Chain A

Receptor sequence

>6f48A (length=302) Species: 2336 (Thermotoga maritima)

HHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAMEL
SEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYR
EKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRN
LGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPEC
PKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREF
VPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFEL
MG

3D structure

• PDB: 6f48 Crystallographic Trapping of Reaction Intermediates in Quinolinic Acid Synthesis by NadA.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.72: quinolinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C81 N109 C168 V170 C254	C85 N113 C172 V174 C258
BS02	XQB	A	H19 F21 D35 S36 M59 N109 H193 E195 T210	H23 F25 D39 S40 M63 N113 H197 E199 T214
BS03	YQA	A	H19 F21 D35 S36 N109 H193 S209 T210	H23 F25 D39 S40 N113 H197 S213 T214

Gene Ontology

Molecular Function

• GO:0008987 quinolinate synthetase A activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009435 NAD biosynthetic process
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0019805 quinolinate biosynthetic process
• GO:0034628 'de novo' NAD biosynthetic process from aspartate

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6f48, PDBe:6f48, PDBj:6f48
• PDBsum: 6f48
• PubMed: 29641168
• UniProt: Q9X1X7|NADA_THEMA Quinolinate synthase (Gene Name=nadA)