Structure of PDB 6esf Chain A

Receptor sequence
>6esfA (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6esf Histone octamer rearranges to adapt to DNA unwrapping.
ChainA
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K37 Y41 T45 R72 R83 F84 R116 V117 T118 K1 Y5 T9 R36 R47 F48 R80 V81 T82
BS02 dna A R40 Y41 R42 V46 R49 R63 K64 L65 R69 R83 R4 Y5 R6 V10 R13 R27 K28 L29 R33 R47
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6esf, PDBe:6esf, PDBj:6esf
PDBsum6esf
PubMed29323273
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]