Structure of PDB 6epr Chain A

Receptor sequence

>6eprA (length=130) Species: 9606 (Homo sapiens)

SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQP
MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA
CALRDTAYAIIKEELDEDFEQLCEEIQESR

3D structure

• PDB: 6epr Hitting a moving target: simulation and crystallography study of ATAD2 bromodomain blockers
• Chain: A
• Resolution: 2.053 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BQE	A	V1008 V1013 Y1063 N1064 D1071 I1074	V30 V35 Y85 N86 D93 I96

External links

• PDB: RCSB:6epr, PDBe:6epr, PDBj:6epr
• PDBsum: 6epr
• UniProt: Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 (Gene Name=ATAD2)