Structure of PDB 6epa Chain A

Receptor sequence

>6epaA (length=183) Species: 7227 (Drosophila melanogaster)

KKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIY
KQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLH
WAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIF
DQMDKNHDDRLTLEEFREGSKADPRMVQALSLG

3D structure

• PDB: 6epa Deciphering the Inhibition of the Neuronal Calcium Sensor 1 and the Guanine Exchange Factor Ric8a with a Small Phenothiazine Molecule for the Rational Generation of Therapeutic Synapse Function Regulators.
• Chain: A
• Resolution: 1.82 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D73 N75 D77 A79 E84	D71 N73 D75 A77 E82
BS02	CA	A	D156 N158 D160 R162 E167	D154 N156 D158 R160 E165
BS03	CA	A	D109 D111 D113 Y115 E120	D107 D109 D111 Y113 E118
BS04	BNQ	A	W30 I51 Y52 F72 F85 T92 W103 L182	W28 I49 Y50 F70 F83 T90 W101 L180	PDBbind-CN: -logKd/Ki=5.95,Kd=1.13uM BindingDB: Kd=1130nM

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0008048 calcium sensitive guanylate cyclase activator activity
• GO:0046872 metal ion binding

Biological Process

• GO:0007268 chemical synaptic transmission
• GO:0007269 neurotransmitter secretion
• GO:0007528 neuromuscular junction development
• GO:0016192 vesicle-mediated transport
• GO:0046928 regulation of neurotransmitter secretion

Cellular Component

• GO:0005737 cytoplasm
• GO:0008021 synaptic vesicle

External links

• PDB: RCSB:6epa, PDBe:6epa, PDBj:6epa
• PDBsum: 6epa
• PubMed: 29966094
• UniProt: Q9VWX8|FRQ2_DROME Frequenin-2 (Gene Name=Frq2)