Structure of PDB 6em3 Chain A

Receptor sequence
>6em3A (length=145) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MNKQRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTLQQLNEIAEL
YNCNNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQGSRPVLSFDQRFESS
PHYQLIKELLVHNFGVPPNARKSKPFIDHVMSFSIVDDKIWVRTY
3D structure
PDB6em3 Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A G40 V41 N42 H45 P63 G13 V14 N15 H18 P36
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000464 endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6em3, PDBe:6em3, PDBj:6em3
PDBsum6em3
PubMed29245012
UniProtQ08235|BRX1_YEAST Ribosome biogenesis protein BRX1 (Gene Name=BRX1)

[Back to BioLiP]