Structure of PDB 6el4 Chain A

Receptor sequence

>6el4A (length=326)

PGLPPGPLENSSAKLVNDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRN
GVATPAQIINAVQEGFNFDNQAAIFATYAAHLVDGNLITDLLSIGRKTRL
TGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNNHDFNETLFEQLVDY
SNRFGGGKYNLTVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGETTFPA
NLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGTGVEVVVQAH
PMQPGRNVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLR
KALNTNLDFLFQGVAAGCTQVFPYGR

3D structure

• PDB: 6el4 Structural Insights into the Substrate Promiscuity of a Laboratory-Evolved Peroxygenase.
• Chain: A
• Resolution: 1.53 Å

Enzymatic activity

• Enzyme Commision number: 1.11.2.1: unspecific peroxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C36 P37 G38 L39 V63 F67 F69 F121 E122 G123 S126 M127 T128 R189 E196 F199 L203 F204	C35 P36 G37 L38 V62 F66 F68 F120 E121 G122 S125 M126 T127 R188 E195 F198 L202 F203
BS02	MG	A	E122 G123 S126	E121 G122 S125
BS03	VOH	A	F69 A77 F121 T192 G195 E196 F199	F68 A76 F120 T191 G194 E195 F198

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:6el4, PDBe:6el4, PDBj:6el4
• PDBsum: 6el4
• PubMed: 30376293
• UniProt: B9W4V6|APO1_CYCAE Aromatic peroxygenase (Gene Name=APO1)