Structure of PDB 6ehj Chain A

Receptor sequence

>6ehjA (length=371) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVV
SSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREI
TRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSMT
MQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQE
EVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIKSLKAAYSFYNV
HTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQ
YYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 6ehj High-resolution snapshots of human N-myristoyltransferase in action illuminate a mechanism promoting N-terminal Lys and Gly myristoylation.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	A	Y117 Q118 F119 W120 Y180 V181 I245 L248 V250 R255 S256 R258 A260 P261 I264 T268 V271 F277 A279 Y281 T282 L287 Y479	Y3 Q4 F5 W6 Y66 V67 I128 L131 V133 R138 S139 R141 A143 P144 I147 T151 V154 F160 A162 Y164 T165 L170 Y354
BS02	ASN	A	G284 Y296 N473	G167 Y179 N348
BS03	SER	A	Y296 H298	Y179 H181
BS04	LYS	A	H298 G470 D471	H181 G345 D346
BS05	PRO	A	H298 F311	H181 F194
BS06	LYS	A	R295 I469	R178 I344
BS07	COA	A	Y117 Q118 F119 W120 Y180 V181 L248 C249 V250 R255 S256 A260 P261 L287	Y3 Q4 F5 W6 Y66 V67 L131 C132 V133 R138 S139 A143 P144 L170

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6ehj, PDBe:6ehj, PDBj:6ehj
• PDBsum: 6ehj
• PubMed: 32111831
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)