Structure of PDB 6ee7 Chain A

Receptor sequence

>6ee7A (length=91) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence]

ADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHK
PHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK

3D structure

PDB

6ee7 Mesoscopic to Macroscopic Electron Transfer by Hopping in a Crystal Network of Cytochromes.

Chain

Resolution

1.394 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	H9 C15 C18 H19 P24 V64 H65	H9 C15 C18 H19 P24 V64 H65
BS02	HEC	A	H9 Q34 C35 C38 H39 H62 V69	H9 Q34 C35 C38 H39 H62 V69
BS03	HEC	A	H39 M45 D46 H49 H52 C58 C61 H62 K72 P73 L89	H39 M45 D46 H49 H52 C58 C61 H62 K72 P73 L89
BS04	HEC	A	P51 H52 N55 L56 C75 C78 H79 R83	P51 H52 N55 L56 C75 C78 H79 R83

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links