Structure of PDB 6edk Chain A

Receptor sequence
>6edkA (length=193) Species: 1212546 (Anoxybacillus ayderensis G10) [Search protein sequence]
QGAMGKILLLGPERKWLRDFLESFEDEVTQYQDKLDKKSAILNNVDFIIS
YGYRYIIHPDIVERFKQRAINLHISYLPWNKGADPNLWSFLEDSPKGVTI
HYIDSGLDTGEIIVQREVTYYENDTLRTTYERLTQTIEKLFMEYWPLIRL
GKIRGIPQPKGGSYHKLKDKEKYLYLLTDGWDTPVQKLIGKAQ
3D structure
PDB6edk Structural Insight into a Novel Formyltransferase and Evolution to a Nonribosomal Peptide Synthetase Tailoring Domain.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 1YA A Y74 R75 Y76 I77 I78 N92 I124 D125 G127 L128 D129 Y185 K187 L188 Y53 R54 Y55 I56 I57 N71 I103 D104 G106 L107 D108 Y164 K166 L167
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 19:35:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6edk', asym_id = 'A', title = 'Structural Insight into a Novel Formyltransferas...Nonribosomal Peptide Synthetase Tailoring Domain.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6edk', asym_id='A', title='Structural Insight into a Novel Formyltransferas...Nonribosomal Peptide Synthetase Tailoring Domain.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009058', uniprot = '', pdbid = '6edk', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009058', uniprot='', pdbid='6edk', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>