Structure of PDB 6e94 Chain A

Receptor sequence

>6e94A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]

PYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQRHER
IHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLST
KRNHEQRHIRE

3D structure

PDB

6e94 Structural insights into methylated DNA recognition by the C-terminal zinc fingers of the DNA reader protein ZBTB38.

Chain

Resolution

1.594 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K1017 H1028 C1031 R1045 F1047 N1052 R1055 H1056 I1059 K1073 H1084 I1087 Y1105 T1108 N1111 R1115	K9 H20 C23 R37 F39 N44 R47 H48 I51 K65 H76 I79 Y97 T100 N103 R107	PDBbind-CN: Kd=5.5nM
BS02	dna	A	Y1010 P1022 S1023 R1055 E1079 R1093 Y1094	Y2 P14 S15 R47 E71 R85 Y86	PDBbind-CN: Kd=5.5nM
BS03	ZN	A	C1040 C1043 H1056 H1060	C32 C35 H48 H52
BS04	ZN	A	C1096 C1099 H1112 H1116	C88 C91 H104 H108
BS05	ZN	A	C1068 C1071 H1084 H1088	C60 C63 H76 H80
BS06	ZN	A	C1012 C1015 H1028 H1032	C4 C7 H20 H24

External links

PDB	RCSB:6e94, PDBe:6e94, PDBj:6e94
PDBsum	6e94
PubMed	30355731
UniProt	Q8NAP3\|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 (Gene Name=ZBTB38)