Structure of PDB 6e7b Chain A

Receptor sequence

>6e7bA (length=428) Species: 9606 (Homo sapiens)

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPDSFNTFFSETGAG
KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT
IGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSV
DYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAI
YDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNL
VPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRH
GKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQP
PTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYV
GEGMEEGEFSEAREDMAALEKDYEEVGV

3D structure

• PDB: 6e7b Human beta-Tubulin Isotypes Can Regulate Microtubule Protofilament Number and Stability.
• Chain: A
• Resolution: 3.5 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G10 Q11 A12 D98 A99 A100 S140 G142 G144 E183 N206 Y224 N228	G10 Q11 A12 D89 A90 A91 S131 G133 G135 E174 N197 Y215 N219

Gene Ontology

Molecular Function

• GO:0003725 double-stranded RNA binding
• GO:0003924 GTPase activity
• GO:0005198 structural molecule activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0031625 ubiquitin protein ligase binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0030705 cytoskeleton-dependent intracellular transport
• GO:0051301 cell division
• GO:0071353 cellular response to interleukin-4

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0005881 cytoplasmic microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:6e7b, PDBe:6e7b, PDBj:6e7b
• PDBsum: 6e7b
• PubMed: 30245156
• UniProt: P68363|TBA1B_HUMAN Tubulin alpha-1B chain (Gene Name=TUBA1B)