Structure of PDB 6e78 Chain A

Receptor sequence

>6e78A (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAAADTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 6e78 Structural Variants of Transthyretin
• Chain: A
• Resolution: 1.499 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1FL	A	L17 A108 L110 S117	L8 A99 L101 S108	BindingDB: IC50=12000nM,Kd=407nM,EC50=5600nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6e78, PDBe:6e78, PDBj:6e78
• PDBsum: 6e78
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)