Structure of PDB 6e6w Chain A

Receptor sequence

>6e6wA (length=174) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

MAMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMY
SDFGHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE
IGVTRREVHIYYLEKANKIEKTHIHIFSFTGEEMATKADYTLDEESRARI
KTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 6e6w SAR Exploration of Tight-Binding Inhibitors of Influenza Virus PA Endonuclease.
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	E80 D108	E61 D89
BS02	MN	A	H41 D108 E119 I120	H43 D89 E100 I101
BS03	HWJ	A	K34 H41 E80 D108 E119 K134	K36 H43 E61 D89 E100 K115	PDBbind-CN: -logKd/Ki=9.96,IC50=110pM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:6e6w, PDBe:6e6w, PDBj:6e6w
• PDBsum: 6e6w
• PubMed: 31536340
• UniProt: C3W5S0