Structure of PDB 6e25 Chain A |
>6e25A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLS DPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK |
|
PDB | 6e25 Picomolar zinc binding modulates formation of Bcl10-nucleating assemblies of the caspase recruitment domain (CARD) of CARD9. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D7 C10 H73 |
D7 C10 H73 |
|
|
|
|