Structure of PDB 6dz0 Chain A

Receptor sequence
>6dz0A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence]
TTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCV
LLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGD
IVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETA
KKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAK
EAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIP
QIGSTEWSETLHNLKNMAQFSVLL
3D structure
PDB6dz0 Selective Inhibitors of Helicobacter pylori Methylthioadenosine Nucleosidase and Human Methylthioadenosine Phosphorylase.
ChainA
Resolution1.62 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T18 P41 H65 I67 M68 A94 M196 T197 D220 D222 V233
Catalytic site (residue number reindexed from 1) T12 P35 H59 I61 M62 A88 M190 T191 D214 D216 V227
Enzyme Commision number 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO4 A G17 T18 R60 H61 T93 T197 G11 T12 R54 H55 T87 T191
BS02 OS3 A T18 H65 A94 C95 G96 F177 I194 N195 M196 T219 D220 D222 V233 V236 T12 H59 A88 C89 G90 F171 I188 N189 M190 T213 D214 D216 V227 V230 MOAD: Kd=0.94nM
PDBbind-CN: -logKd/Ki=9.03,Kd=0.94nM
BindingDB: Kd=0.940000nM
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004645 1,4-alpha-oligoglucan phosphorylase activity
GO:0005515 protein binding
GO:0016757 glycosyltransferase activity
GO:0016763 pentosyltransferase activity
GO:0017061 S-methyl-5-thioadenosine phosphorylase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006166 purine ribonucleoside salvage
GO:0006738 nicotinamide riboside catabolic process
GO:0009116 nucleoside metabolic process
GO:0019509 L-methionine salvage from methylthioadenosine
GO:0032259 methylation
GO:0033574 response to testosterone
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dz0, PDBe:6dz0, PDBj:6dz0
PDBsum6dz0
PubMed30860833
UniProtQ13126|MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase (Gene Name=MTAP)

[Back to BioLiP]