Structure of PDB 6dyg Chain A

Receptor sequence

>6dygA (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMWDFRHGFDHLVYHIDDALKLANEGKVKEAQAAAEQLKCHCNA
CHQKYR

3D structure

• PDB: 6dyg An efficient, step-economical strategy for the design of functional metalloproteins.
• Chain: A
• Resolution: 1.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	M7 N11 F61 G64 F65 C98 C101 H102 Y105 R106	M7 N11 F61 G64 F65 C98 C101 H102 Y105 R106
BS02	FE	A	H67 H71 H97	H67 H71 H97

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:6dyg, PDBe:6dyg, PDBj:6dyg
• PDBsum: 6dyg
• PubMed: 30778140
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)