Structure of PDB 6du4 Chain A

Receptor sequence

>6du4A (length=287) Species: 9606 (Homo sapiens)

KSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRA
LTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHLRRGIDIGT
GASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVP
QKTLLMDALSEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTGG
ITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRI
QGVPKVTYTEFCQGRTMRWALAWSFYDDVTVPSPPSK

3D structure

• PDB: 6du4 Structural Basis for Regulation of METTL16, an S-Adenosylmethionine Homeostasis Factor.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.346: U6 snRNA m(6)A methyltransferase.
  2.1.1.348: mRNA m(6)A methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P18 F20 L38 R41 F46 K47 L75 T78 P80 L81 F187 F188 S199 R200 N201 R203 R204 P205 P206 P207 S208 S209 V210 N211 I218 G250 K252 Q277 G278 R279 T280 M281 R282 W283	P14 F16 L34 R37 F42 K43 L71 T74 P76 L77 F173 F174 S185 R186 N187 R189 R190 P191 P192 P193 S194 S195 V196 N197 I204 G236 K238 Q263 G264 R265 T266 M267 R268 W269

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity

External links

• PDB: RCSB:6du4, PDBe:6du4, PDBj:6du4
• PDBsum: 6du4
• PubMed: 30197297
• UniProt: Q86W50|MET16_HUMAN RNA N6-adenosine-methyltransferase METTL16 (Gene Name=METTL16)