Structure of PDB 6dnt Chain A

Receptor sequence

>6dntA (length=310) Species: 634498 (Methanobrevibacter ruminantium M1)

MKDKNVVVTGGLGFIGSHIVDALIDDNKVTIIDNLSSGKMENLNNPNHEN
LTIIKEDLMDADLEKILKDKDYVFHLAALASVPGSVAEPLRYNQNNIDAS
LKLFIACKNNNIKKVIFSSSSAVYGENPNMPLKESENFLPCSPYAAQKAS
CELYLKSFHESYGLDYVALRYFNVFGPRQDENSPYAAVIPKFISAILNGE
SPVIYGDGEQSRDFIYVKEIAKANILSAESDYNGVINVALGKSMTINRLF
EIISDVLESDIDVKYLDERPGDIKHSLADISNLDKISFKPDEDKFEEQLR
ETVKWFISQM

3D structure

• PDB: 6dnt Structural determination of archaeal UDP-N-acetylglucosamine 4-epimerase from Methanobrevibacter ruminantium M1 in complex with the bacterial cell wall intermediate UDP-N-acetylmuramic acid.
• Chain: A
• Resolution: 1.66 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S120 S121 A122 Y144 K148 A187
• Catalytic site (residue number reindexed from 1): S120 S121 A122 Y144 K148 A187

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G10 G13 F14 I15 D33 N34 L35 S36 S37 G38 D57 L58 L76 A77 A78 A80 S118 S119 Y144 K148 Y171 V174	G10 G13 F14 I15 D33 N34 L35 S36 S37 G38 D57 L58 L76 A77 A78 A80 S118 S119 Y144 K148 Y171 V174
BS02	EPZ	A	A80 S120 S121 Y144 F172 N173 A187 V188 K191 V203 I204 Y205 Q210 R212 I246 R269 D272	A80 S120 S121 Y144 F172 N173 A187 V188 K191 V203 I204 Y205 Q210 R212 I246 R269 D272
BS03	ZN	A	E209 H275	E209 H275

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:6dnt, PDBe:6dnt, PDBj:6dnt
• PDBsum: 6dnt
• PubMed: 30242905
• UniProt: D3E402