Structure of PDB 6dhp Chain A

Receptor sequence

>6dhpA (length=334) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDI
DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGG
PYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGAL
FCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAK
GNVINTWADIINRANLGMEVMHERNAHNFPLDLA

3D structure

PDB

6dhp Structures of the intermediates of Kok's photosynthetic water oxidation clock.

Chain

Resolution

2.04 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OEX	A	D170 E189 H332 E333 H337 D342 A344	D160 E179 H322 E323 H327 D332 A334
BS02	FE2	A	H215 H272	H205 H262
BS03	CLA	A	P150 S153 M183 F186 I192 H198 G201 V202 F206 T286 I290	P140 S143 M173 F176 I182 H188 G191 V192 F196 T276 I280
BS04	CLA	A	Q199 V202 A203 F206 G207 W278	Q189 V192 A193 F196 G197 W268
BS05	PHO	A	L41 A44 T45 F48 Y126 A146 Y147 P150 P279	L31 A34 T35 F38 Y116 A136 Y137 P140 P269
BS06	PHO	A	F206 A209 L210 M214	F196 A199 L200 M204
BS07	CLA	A	T40 F93 P95 I96 W97 L114 F117 H118	T30 F83 P85 I86 W87 L104 F107 H108
BS08	CLA	A	M172 T179 M183	M162 T169 M173
BS09	OEY	A	D170 E189 H332 E333 H337 D342 A344	D160 E179 H322 E323 H327 D332 A334
BS10	CLA	A	F33 W131	F23 W121
BS11	BCT	A	H215 Y246 H272	H205 Y236 H262

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6dhp, PDBe:6dhp, PDBj:6dhp
PDBsum	6dhp
PubMed	30405241
UniProt	P0A444\|PSBA1_THEVB Photosystem II protein D1 1 (Gene Name=psbA1)

[Back to BioLiP]